Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Brain-derived neurotrophic factor (BDNF) (R225E, R245E)

This Recombinant Human Brain-derived neurotrophic factor (BDNF) (R225E, R245E) spans the amino acid sequence from region 129-247aa (R225E, R245E) . Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Abrineurin

UniProt

P23560

Expression Region

129-247aa (R225E, R245E)

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKEIGWRFIRIDTSCVCTLTIKEGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FHOD1 (NM_013241) Human Recombinant Protein
PH38390M5 20 µg

FHOD1 (NM_013241) Human Recombinant Protein

Sign In for Pricing
View Details
DSG4 CRISPRa sgRNA lentivector (set of three targets)(Rat)
18630126 3x 1.0µg DNA

DSG4 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
β-Arrestin 2 Antibody
E90142 100 µL

β-Arrestin 2 Antibody

Sign In for Pricing
View Details
NOP2 Adenovirus (Rat)
32000056 1.0 mL

NOP2 Adenovirus (Rat)

Sign In for Pricing
View Details
Anti-S6K1/RPS6KB1 Antibody Picoband®, APC Conjugate
A01475-2-APC 100 µg/Vial

Anti-S6K1/RPS6KB1 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
GADD45A (Growth Arrest and DNA Damage-inducible Protein GADD45 alpha, DDIT1, DDIT-1, DDIT1, GADD45, GA45A)
316702-01 50 µL

GADD45A (Growth Arrest and DNA Damage-inducible Protein GADD45 alpha, DDIT1, DDIT-1, DDIT1, GADD45, GA45A)

Sign In for Pricing
View Details