Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human L-lactate dehydrogenase B chain (LDHB)

This Recombinant Human L-lactate dehydrogenase B chain (LDHB) spans the amino acid sequence from region 2-334aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LDH heart subunit ; LDH-HRenal carcinoma antigen NY-REN-46

UniProt

P07195

Expression Region

2-334aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Ankrd13d Pre-designed siRNA Set B
SI200634B 1 Each

Rat Ankrd13d Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Murid herpesvirus 1 Envelope glycoprotein H (gH), partial
MBS7059875 Inquire

Recombinant Murid herpesvirus 1 Envelope glycoprotein H (gH), partial

Sign In for Pricing
View Details
SMOC2
334906-01 50 µL

SMOC2

Sign In for Pricing
View Details
SMOC2
334906-02 100 µL

SMOC2

Sign In for Pricing
View Details
Antibacterial agent 193
T209261-01 10 mg

Antibacterial agent 193

Sign In for Pricing
View Details
Antibacterial agent 193
T209261-02 50 mg

Antibacterial agent 193

Sign In for Pricing
View Details