Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human L-lactate dehydrogenase B chain (LDHB)

This Recombinant Human L-lactate dehydrogenase B chain (LDHB) spans the amino acid sequence from region 2-334aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LDH heart subunit ; LDH-HRenal carcinoma antigen NY-REN-46

UniProt

P07195

Expression Region

2-334aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FABP6 (NM_001445) Human Tagged Lenti ORF Clone
RC205307L3 10 µg

FABP6 (NM_001445) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Ilginatinib hydrochloride
E4630-5mg 5 mg

Ilginatinib hydrochloride

Sign In for Pricing
View Details
PCDHGA1 (m) -PR
sc-152085-PR 10 µM - 20 µL

PCDHGA1 (m) -PR

Sign In for Pricing
View Details
FXYD5 ORF Vector (Human) (pORF)
21096011 1.0 µg DNA

FXYD5 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
HIV-1, gp41 (Human Immunodeficiency Virus 1 gp41) (MaxLight 550)
MBS6444235-01 0.1 mL

HIV-1, gp41 (Human Immunodeficiency Virus 1 gp41) (MaxLight 550)

Sign In for Pricing
View Details
HIV-1, gp41 (Human Immunodeficiency Virus 1 gp41) (MaxLight 550)
MBS6444235-02 5x 0.1 mL

HIV-1, gp41 (Human Immunodeficiency Virus 1 gp41) (MaxLight 550)

Sign In for Pricing
View Details