Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Deoxyribonuclease gamma (DNASE1L3)

This Recombinant Human Deoxyribonuclease gamma (DNASE1L3) spans the amino acid sequence from region 21-305aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DNase I homolog protein DHP2 Deoxyribonuclease I-like 3 Short name: DNase I-like 3 Liver and spleen DNase Short name: LS-DNase Short name: LSD

UniProt

Q13609

Expression Region

21-305aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SSX2IP Antibody
RC-4892-01 50 μL

Recombinant SSX2IP Antibody

Sign In for Pricing
View Details
Recombinant SSX2IP Antibody
RC-4892-02 100 µL

Recombinant SSX2IP Antibody

Sign In for Pricing
View Details
Recombinant SSX2IP Antibody
RC-4892-03 1 mL

Recombinant SSX2IP Antibody

Sign In for Pricing
View Details
KLK5 Immunizing Peptide
orb15916 100 µg

KLK5 Immunizing Peptide

Sign In for Pricing
View Details
2- (2-Aminoethyl) sulphonylpyridine dihydrochloride
OR12959 1 Each

2- (2-Aminoethyl) sulphonylpyridine dihydrochloride

Sign In for Pricing
View Details
Recombinant Human PPARG Protein, N-His
E55P6932 50 µg

Recombinant Human PPARG Protein, N-His

Sign In for Pricing
View Details