Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Platelet-derived growth factor D (PDGFD), partial

This Recombinant Human Platelet-derived growth factor D (PDGFD), partial spans the amino acid sequence from region 55-168aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PDGF-D; Iris-expressed growth factor; Spinal cord-derived growth factor B; SCDGF-B; PDGFD latent form; PDGFD receptor-binding form

UniProt

Q9GZP0

Expression Region

55-168aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TIQVKGNGYVQSPRFPNSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDISETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal THYN1 Antibody
NBP2-98501-50ul 50 µL

Rabbit Polyclonal THYN1 Antibody

Sign In for Pricing
View Details
Tyrosinase shRNA Plasmid (m)
sc-36767-SH 20 µg

Tyrosinase shRNA Plasmid (m)

Sign In for Pricing
View Details
Recombinant Human F-box/ LRR-repeat protein 18 Protein, His-SUMO, E.coli-500ug
QP6024-ec-500ug 500ug

Recombinant Human F-box/ LRR-repeat protein 18 Protein, His-SUMO, E.coli-500ug

Sign In for Pricing
View Details
Rat Ubxn6 Pre-designed siRNA Set A
SI215569A 1 Each

Rat Ubxn6 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Doublecortin (E-6) Alexa Fluor® 488
sc-271390 AF488 200 µg/mL

Doublecortin (E-6) Alexa Fluor® 488

Sign In for Pricing
View Details
Fmoc-Asp (OtBu) -Ser (Psi (Me, Me) pro) -OH
OR36442-01 250 mg

Fmoc-Asp (OtBu) -Ser (Psi (Me, Me) pro) -OH

Sign In for Pricing
View Details