Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein KPLCE (KPLCE)

This Recombinant Human Protein KPLCE (KPLCE) spans the amino acid sequence from region 1-250aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KPRP N-terminal and LCE C-terminal-like protein; Skin-specific protein 32

UniProt

Q5T750

Expression Region

1-250aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCDQQKQPQFPPSCVKGSGLGAGQGSNGASVKCPVPCQTQTVCVTGPAPCPTQTYVKYQVPCQTQTYVKCPAPCQRTYVKYPTPCQTYVKCPAPCQTTYVKCPTPCQTYVKCPAPCQMTYIKSPAPCQTQTCYVQGASPCQSYYVQAPASGSTSQYCVTDPCSAPCSTSYCCLAPRTFGVSPLRRWIQRPQNCNTGSSGCCENSGSSGCCGSGGCGCSCGCGSSGCCCLGIIPMRSRGPACCDHEDDCCC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RAD17 Protein, N-His
E55P7673 50 µg

Recombinant Human RAD17 Protein, N-His

Sign In for Pricing
View Details
Psmb7 (NM_053532) Rat Tagged ORF Clone Lentiviral Particle
RR208386L3V 200 µL

Psmb7 (NM_053532) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Monoclonal ATRIP Antibody (OTI5E7) [Allophycocyanin]
NBP2-72271APC 0.1 mL

Mouse Monoclonal ATRIP Antibody (OTI5E7) [Allophycocyanin]

Sign In for Pricing
View Details
DYNLL2 (Dynein Light Chain 2, Cytoplasmic, 8kD Dynein Light Chain B, DLC8b, Dynein Light Chain LC8-type 2, DLC2, MGC17810) (AP) discontinued
126094-AP 100 µL

DYNLL2 (Dynein Light Chain 2, Cytoplasmic, 8kD Dynein Light Chain B, DLC8b, Dynein Light Chain LC8-type 2, DLC2, MGC17810) (AP) discontinued

Sign In for Pricing
View Details
NAT8B Polyclonal Conjugated Antibody
MBS9439890-01 0.1 mL (Biotin)

NAT8B Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
NAT8B Polyclonal Conjugated Antibody
MBS9439890-02 0.1 mL (AF350)

NAT8B Polyclonal Conjugated Antibody

Sign In for Pricing
View Details