Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein KPLCE (KPLCE)

This Recombinant Human Protein KPLCE (KPLCE) spans the amino acid sequence from region 1-250aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KPRP N-terminal and LCE C-terminal-like protein; Skin-specific protein 32

UniProt

Q5T750

Expression Region

1-250aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCDQQKQPQFPPSCVKGSGLGAGQGSNGASVKCPVPCQTQTVCVTGPAPCPTQTYVKYQVPCQTQTYVKCPAPCQRTYVKYPTPCQTYVKCPAPCQTTYVKCPTPCQTYVKCPAPCQMTYIKSPAPCQTQTCYVQGASPCQSYYVQAPASGSTSQYCVTDPCSAPCSTSYCCLAPRTFGVSPLRRWIQRPQNCNTGSSGCCENSGSSGCCGSGGCGCSCGCGSSGCCCLGIIPMRSRGPACCDHEDDCCC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF420 Human Gene Knockout Kit (CRISPR)
KN401401 1 Kit

ZNF420 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(1R) -1- (2,5-Dimethylphenyl) ethan-1-ol
AXB67254-01 100 mg

(1R) -1- (2,5-Dimethylphenyl) ethan-1-ol

Sign In for Pricing
View Details
(1R) -1- (2,5-Dimethylphenyl) ethan-1-ol
AXB67254-02 1 g

(1R) -1- (2,5-Dimethylphenyl) ethan-1-ol

Sign In for Pricing
View Details
4- (2-Aminoethyl) amino-6-bromo-3-chloroquinoline
OR1076205 25 g

4- (2-Aminoethyl) amino-6-bromo-3-chloroquinoline

Sign In for Pricing
View Details
Mouse StAR-related lipid transfer protein 5, Stard5 ELISA KIT
ELI-18694m 96 Tests

Mouse StAR-related lipid transfer protein 5, Stard5 ELISA KIT

Sign In for Pricing
View Details
Cytoglobin Antibody
R30742 100 µg

Cytoglobin Antibody

Sign In for Pricing
View Details