Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri Cold shock-like protein CspE (cspE)

This Recombinant Shigella flexneri Cold shock-like protein CspE (cspE) spans the amino acid sequence from region 2-69aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CSP-E

UniProt

P0A975

Expression Region

2-69aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Shigella flexneri

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVIAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD55 (CD55 Antigen, CD55 Molecule, Complement Decay Accelerating Factor, CR, Cromer Blood Group Antigen, Cromer Blood Group System, CROM, Decay Accelerating Factor for Complement, DAF, TC) discontinued. see C2410-01E
C2410-01G 100 µg

CD55 (CD55 Antigen, CD55 Molecule, Complement Decay Accelerating Factor, CR, Cromer Blood Group Antigen, Cromer Blood Group System, CROM, Decay Accelerating Factor for Complement, DAF, TC) discontinued. see C2410-01E

Sign In for Pricing
View Details
Encephalopsin (OPN3) (NM_014322) Human Tagged Lenti ORF Clone
RC207753L4 10 µg

Encephalopsin (OPN3) (NM_014322) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Obox3 shRNA (UAS) - Lentiviral mouse Obox3 shRNA (UAS, iRFP) plasmid
GTR15282448 1 Vial

Lentiviral mouse Obox3 shRNA (UAS) - Lentiviral mouse Obox3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Lentiviral human LIPM shRNA (UAS) - Lentiviral human LIPM shRNA (UAS) (100)
GTR15130110 1 Vial

Lentiviral human LIPM shRNA (UAS) - Lentiviral human LIPM shRNA (UAS) (100)

Sign In for Pricing
View Details
1-hydroxy-7,9a-dimethyl-3-oxo-2,3,7,8,9,9a-hexahydro-1H-benzo[7]annulene-6-carboxylic acid
orb3179263-01 1 mg

1-hydroxy-7,9a-dimethyl-3-oxo-2,3,7,8,9,9a-hexahydro-1H-benzo[7]annulene-6-carboxylic acid

Sign In for Pricing
View Details
1-hydroxy-7,9a-dimethyl-3-oxo-2,3,7,8,9,9a-hexahydro-1H-benzo[7]annulene-6-carboxylic acid
orb3179263-02 2 mg

1-hydroxy-7,9a-dimethyl-3-oxo-2,3,7,8,9,9a-hexahydro-1H-benzo[7]annulene-6-carboxylic acid

Sign In for Pricing
View Details