Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Arginine permease CAN1 (CAN1), partial

This Recombinant Saccharomyces cerevisiae Arginine permease CAN1 (CAN1), partial spans the amino acid sequence from region 1-92aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Canavanine resistance protein 1

UniProt

P04817

Expression Region

1-92aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTNSKEDADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVNGEDTFSMEDGIGDEDEGEVQNAEVKRELKQRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein A Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS
MGW06F-PA/W 10x 96 Well Plates

Protein A Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS

Sign In for Pricing
View Details
FITC Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09813C-01 25 µg

FITC Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
FITC Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09813C-02 100 µg

FITC Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
Calpain 1 Mouse Monoclonal Antibody [2A2]
EM1801-03 100 µL

Calpain 1 Mouse Monoclonal Antibody [2A2]

Sign In for Pricing
View Details
PACSIN2 Human Gene Knockout Kit (CRISPR)
KN400237 1 Kit

PACSIN2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS802495 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details