Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial
This Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial spans the amino acid sequence from region 7-99 aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
68 TATA-binding protein-associated factor; TAF (II; TAFII68; RNA-binding protein 56
UniProt
Q92804
Expression Region
7-99 aa
Tag
N-terminal 6xHis-Trx-tagged and C-terminal 6xHis-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Epigenetics & Chromatin
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
29.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
YGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K0057803 1.0 µg DNA
AGFG2 sgRNA CRISPR Lentivector (Human) (Target 2)
Sign In for Pricing
View Details 135500 100 µg
ZAP70 (70kD zeta-chain Associated Protein, ZAP-70, Tyrosine-protein Kinase ZAP-70, Syk-related Tyrosine Kinase, SRK, STCD, STD, TZK)
Sign In for Pricing
View Details NBP2-70747AF594 0.1 mL
Mouse Monoclonal FOXI1 Antibody (OTI1D4) [Alexa Fluor 594]
Sign In for Pricing
View Details 
ARP49967_P050-HRP 100 µL
SGPP1 Antibody - middle region : HRP (ARP49967_P050-HRP)
Sign In for Pricing
View Details