Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vacuolar protein sorting-associated protein 29 (VPS29), partial

This Recombinant Human Vacuolar protein sorting-associated protein 29 (VPS29), partial spans the amino acid sequence from region 68-145aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HVPS29; PEP11 homolog; Vesicle protein sorting 29

UniProt

Q9UBQ0

Expression Region

68-145aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DENLNYPEQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASTE1 CytoSection
TS418869P5 25 Slides

ASTE1 CytoSection

Sign In for Pricing
View Details
BDKRB1 (NM_000710) Human Over-expression Lysate
LH20047V 100 µg

BDKRB1 (NM_000710) Human Over-expression Lysate

Sign In for Pricing
View Details
Quick Step Human Neurotensin, NT ELISA Kit
QS1265Hu-01 48 Tests

Quick Step Human Neurotensin, NT ELISA Kit

Sign In for Pricing
View Details
Quick Step Human Neurotensin, NT ELISA Kit
QS1265Hu-02 96 Tests

Quick Step Human Neurotensin, NT ELISA Kit

Sign In for Pricing
View Details
1-phosphatidylinositol 4, 5-bisphosphate phosphodiesterase beta-1
AP87240 1 mg

1-phosphatidylinositol 4, 5-bisphosphate phosphodiesterase beta-1

Sign In for Pricing
View Details
CalmL3 Rat siRNA Oligo Duplex (Locus ID 307100)
SR508582 1 Kit

CalmL3 Rat siRNA Oligo Duplex (Locus ID 307100)

Sign In for Pricing
View Details