Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 10 (FGF10) (Active)

This Recombinant Human Fibroblast growth factor 10 (FGF10) (Active) spans the amino acid sequence from region 38-208aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast growth factor 10; FGF-10; Keratinocyte growth factor 2; FGF10; KGF-2; KGF2

UniProt

O15520

Expression Region

38-208aa

Tag

Tag free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured in a cell proliferation assay using Mv.1.Lu Mink lung epithelial cells. The ED50 for this effect is ≤10 ng/mL.

Form

Lyophilized powder

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

AA Sequence

QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF594 conjugate, 0.1mg/mL
BNC942831-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR pTyr1069 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 11C2]
AM00034PU-N 100 µg

EGFR pTyr1069 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 11C2]

Sign In for Pricing
View Details
Hepacam (NM_175189) Mouse Recombinant Protein
TP518344 20 µg

Hepacam (NM_175189) Mouse Recombinant Protein

Sign In for Pricing
View Details
Salicylaldehyde
TRC-S088145-500G 500 g

Salicylaldehyde

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD40 Antibody[G28.5]
E-AB-F1214M-01 20 Tests

Elab Fluor® 647 Anti-Human CD40 Antibody[G28.5]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD40 Antibody[G28.5]
E-AB-F1214M-02 100 Tests

Elab Fluor® 647 Anti-Human CD40 Antibody[G28.5]

Sign In for Pricing
View Details