Recombinant Human Fibroblast growth factor 10 (FGF10) (Active)
This Recombinant Human Fibroblast growth factor 10 (FGF10) (Active) spans the amino acid sequence from region 38-208aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Fibroblast growth factor 10; FGF-10; Keratinocyte growth factor 2; FGF10; KGF-2; KGF2
UniProt
O15520
Expression Region
38-208aa
Tag
Tag free
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Stem Cell & Developmental Biology
Endotoxin
≤10 EU/mg by the LAL method
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured in a cell proliferation assay using Mv.1.Lu Mink lung epithelial cells. The ED50 for this effect is ≤10 ng/mL.
Form
Lyophilized powder
Molecular Weight
19.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
AA Sequence
QALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400393-500 1x 500 µL
Cytokeratin, multi (C11), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740370-100 1x 100 µL
CD117 (C117/370), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882391-500 1x 500 µL
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2391), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472308-500 1x 500 µL
HSP27 (Heat Shock Protein 27) (rHSPB1/774), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042180-100 1x 100 µL
EGFR (Epidermal Growth Factor Receptor) (F4), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details