Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Platelet-derived growth factor subunit B (PDGFB) (Active)

This Recombinant Human Platelet-derived growth factor subunit B (PDGFB) (Active) spans the amino acid sequence from region 82-190aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PDGFBB; PDGF-BB

UniProt

P01127

Expression Region

82-190aa

Tag

Tag free

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured in a cell proliferation assay using NIH3T3 mouse embryonic fibroblast cells. The ED50 for this effect is ≤5 ng/mL.

Form

Lyophilized powder

Molecular Weight

12.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing 100mM Citratesodium citrate, 5% Mannitol 0.1% Trehalose pH 6.5

AA Sequence

SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ILVBL Polyclonal Antibody
A72464-100 100 µL

ILVBL Polyclonal Antibody

Sign In for Pricing
View Details
ProCollagen Type III (PIIINP) (MaxLight 405)
MBS6494517-01 0.1 mL

ProCollagen Type III (PIIINP) (MaxLight 405)

Sign In for Pricing
View Details
ProCollagen Type III (PIIINP) (MaxLight 405)
MBS6494517-02 5x 0.1 mL

ProCollagen Type III (PIIINP) (MaxLight 405)

Sign In for Pricing
View Details
F2 Mouse shRNA Plasmid (Locus ID 14061)
TR500650 1 Kit

F2 Mouse shRNA Plasmid (Locus ID 14061)

Sign In for Pricing
View Details
B230118H07Rik sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3492603 1.0 µg DNA

B230118H07Rik sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
WASP Antibody
E18-4077-2 100 µg -100 µL

WASP Antibody

Sign In for Pricing
View Details