Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Platelet-derived growth factor subunit B (PDGFB) (Active)

This Recombinant Human Platelet-derived growth factor subunit B (PDGFB) (Active) spans the amino acid sequence from region 82-190aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PDGFBB; PDGF-BB

UniProt

P01127

Expression Region

82-190aa

Tag

Tag free

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured in a cell proliferation assay using NIH3T3 mouse embryonic fibroblast cells. The ED50 for this effect is ≤5 ng/mL.

Form

Lyophilized powder

Molecular Weight

12.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing 100mM Citratesodium citrate, 5% Mannitol 0.1% Trehalose pH 6.5

AA Sequence

SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTR8 Polyclonal Antibody
E44H08961 100 µL

GTR8 Polyclonal Antibody

Sign In for Pricing
View Details
13-Epimanool
orb1683910 5 mg

13-Epimanool

Sign In for Pricing
View Details
Rat Monoclonal IL-17RA/IL-17R Antibody (657603) [HRP]
FAB4481H 0.1 mL

Rat Monoclonal IL-17RA/IL-17R Antibody (657603) [HRP]

Sign In for Pricing
View Details
RPL6P29 AAV Vector (Human) (CMV)
41773101 1 µg

RPL6P29 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
ARL10, ID (ARL10, ARL10A, ADP-ribosylation factor-like protein 10) (AP) discontinued
032065-AP 200 µL

ARL10, ID (ARL10, ARL10A, ADP-ribosylation factor-like protein 10) (AP) discontinued

Sign In for Pricing
View Details
FREM1 Antibody, Biotin conjugated
CSB-PA686013LD01HU-01 50 µg

FREM1 Antibody, Biotin conjugated

Sign In for Pricing
View Details