Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-epidermal growth factor (EGF), partial (Active)

This Recombinant Human Pro-epidermal growth factor (EGF), partial (Active) spans the amino acid sequence from region 971-1023aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pro-Epidermal Growth Factor; EGF; Epidermal Growth Factor; Urogastrone

UniProt

P01133

Expression Region

971-1023aa

Tag

Tag free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Stem Cell & Developmental Biology

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured in a cell proliferation assay using NIH3T3 mouse embryonic fibroblast Cells. The ED50 for this effect ≤0.3 ng/mL.

Form

Lyophilized powder

Molecular Weight

6.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

AA Sequence

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf174-set siRNA/shRNA/RNAi Lentivector (Human)
14795091 4x 500 ng

C9orf174-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
COX6B2 Protein Lysate (Mouse) with C-HA Tag
16708035 100 µg

COX6B2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
IZUMO4 Rabbit Polyclonal Antibody
orb582132 100 µL

IZUMO4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-NETO2 Antibody Picoband®, Carrier-free
A09555-1-carrier-free 100 µg/Vial

Anti-NETO2 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
GENLISA™ Human Natural cytotoxicity triggering receptor 2 (NKp44/NCR2) ELISA
KBH21763 96 Well

GENLISA™ Human Natural cytotoxicity triggering receptor 2 (NKp44/NCR2) ELISA

Sign In for Pricing
View Details
IRX3, NT (IRX3, IRXB1, Iroquois-class homeodomain protein IRX-3, Homeodomain protein IRXB1, Iroquois homeobox protein 3) (FITC) discontinued
037114-FITC 200 µL

IRX3, NT (IRX3, IRXB1, Iroquois-class homeodomain protein IRX-3, Homeodomain protein IRXB1, Iroquois homeobox protein 3) (FITC) discontinued

Sign In for Pricing
View Details