Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-epidermal growth factor (EGF), partial (Active)

This Recombinant Human Pro-epidermal growth factor (EGF), partial (Active) spans the amino acid sequence from region 971-1023aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pro-Epidermal Growth Factor; EGF; Epidermal Growth Factor; Urogastrone

UniProt

P01133

Expression Region

971-1023aa

Tag

Tag free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Stem Cell & Developmental Biology

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured in a cell proliferation assay using NIH3T3 mouse embryonic fibroblast Cells. The ED50 for this effect ≤0.3 ng/mL.

Form

Lyophilized powder

Molecular Weight

6.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

AA Sequence

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMB8 (NM_148919) Human Tagged ORF Clone Lentiviral Particle
RC224611L4V 200 µL

PSMB8 (NM_148919) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human PGAP2 knockout cell line
ABC-KH11446 1 Vial

Human PGAP2 knockout cell line

Sign In for Pricing
View Details
CFHL1 (CFHR1) (NM_002113) Human Tagged ORF Clone Lentiviral Particle
RC210472L2V 200 µL

CFHL1 (CFHR1) (NM_002113) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Goose Long-Chain Fatty Acyl CoA ELISA Kit
MBS014665 Inquire

Goose Long-Chain Fatty Acyl CoA ELISA Kit

Sign In for Pricing
View Details
CCDC160 Rabbit Polyclonal Antibody (BF594)
orb2386822 100 µL

CCDC160 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
GP73 (E-7) : m-IgG Fc BP-HRP Bundle
sc-526277 1 Kit

GP73 (E-7) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details