Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transforming growth factor beta-1 proprotein (TGFB1), partial (Active)

This Recombinant Human Transforming growth factor beta-1 proprotein (TGFB1), partial (Active) spans the amino acid sequence from region 279-390aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transforming Growth Factor Beta-1; TGF-Beta-1; Latency-Associated Peptide; LAP; TGFB1; TGFB

UniProt

P01137

Expression Region

279-390aa

Tag

Tag free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured in a cell inhibition assay using TF-1 cells at IL4 presence. The ED50 for this effect is ≤0.1ng/mL.

Form

Lyophilized powder

Molecular Weight

12.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing 0.085% TFA,30% ACN, 5% mannitol, pH 2.5

AA Sequence

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NYD-SP29 Lentiviral Activation Particles (h)
sc-410284-LAC 200 µL

NYD-SP29 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Mouse Cysrt1/Cysteine-rich tail protein 1 ELISA Kit
MBS2906942-01 48 Well

Mouse Cysrt1/Cysteine-rich tail protein 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Cysrt1/Cysteine-rich tail protein 1 ELISA Kit
MBS2906942-02 96 Well

Mouse Cysrt1/Cysteine-rich tail protein 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Cysrt1/Cysteine-rich tail protein 1 ELISA Kit
MBS2906942-03 5x 96 Well

Mouse Cysrt1/Cysteine-rich tail protein 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Cysrt1/Cysteine-rich tail protein 1 ELISA Kit
MBS2906942-04 10x 96 Well

Mouse Cysrt1/Cysteine-rich tail protein 1 ELISA Kit

Sign In for Pricing
View Details
SLCO3A1 Antibody, HRP conjugated
A69925-50UG 50 µg

SLCO3A1 Antibody, HRP conjugated

Sign In for Pricing
View Details