Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active)

This Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active) spans the amino acid sequence from region 10-155aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB

UniProt

P03969

Expression Region

10-155aa

Tag

Tag free

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology

Endotoxin

≤200 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured in a cell proliferation assay using NIH3T3 mouse embryonic fibroblast cells. The ED50 for this effect is ≤2.0 ng/mL

Form

Lyophilized powder

Molecular Weight

16.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing 10mMPB, 250mMNaCl,5%mannitol and 0.01% Tween 80 , pH 7.4

AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6820408C15Rik Mouse Gene Knockout Kit (CRISPR)
KN500493 1 Kit

6820408C15Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EFCAB5 Rabbit Polyclonal Antibody
TA368219 100 µL

EFCAB5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Hydroxybenzenesulfonic Acid Ammonium Salt
TRC-H807815-5G 5 g

4-Hydroxybenzenesulfonic Acid Ammonium Salt

Sign In for Pricing
View Details
Ubiquitin (Autophagy Marker) (UBB/3143R), CF647 conjugate, 0.1mg/mL
BNC473143-500 1x 500 µL

Ubiquitin (Autophagy Marker) (UBB/3143R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.7), CF647 conjugate, 0.1mg/mL
BNC470014-500 1x 500 µL

CD31 / PECAM-1 (C31.7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
6-Ethylchenodeoxycholic-d5 Acid
TRC-E899812-2.5MG 2.5 mg

6-Ethylchenodeoxycholic-d5 Acid

Sign In for Pricing
View Details