Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vitronectin (VTN) (Active)

This Recombinant Human Vitronectin (VTN) (Active) spans the amino acid sequence from region 20-478aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vitronectin; VN; S-Protein; Serum-Spreading Factor; V75; VTN

UniProt

P04004

Expression Region

20-478aa

Tag

Tag free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by the ability of the immobilized protein to support the adhesion of NIH3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 2-10 μg/mL. Optimal concentration depends on cell type as well as the application or research objectives.

Form

Liquid

Molecular Weight

52.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

0.2 μm-filtered solution containing PBS,5% mannitol and 0.01% Tween 80, pH 7.4

AA Sequence

DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PTK2B/PYK2 Antibody , PE
E55A10672 50 Tests

Human PTK2B/PYK2 Antibody , PE

Sign In for Pricing
View Details
C14orf177 Antibody, Biotin conjugated
A57107-100UG 100 µg

C14orf177 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Dusigitumab Biosimilar - Research Grade
ICH5494-50mg 50 mg

Dusigitumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Phospho-Integrin beta 1 (Tyr783) Polyclonal Antibody, Biotin Conjugated
bs-16635R-Biotin 100 µL

Phospho-Integrin beta 1 (Tyr783) Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Recombinant Bacillus halodurans Phosphate acyltransferase (plsX)
MBS1422429-01 0.02 mg (E-Coli)

Recombinant Bacillus halodurans Phosphate acyltransferase (plsX)

Sign In for Pricing
View Details
Recombinant Bacillus halodurans Phosphate acyltransferase (plsX)
MBS1422429-02 0.02 mg (Yeast)

Recombinant Bacillus halodurans Phosphate acyltransferase (plsX)

Sign In for Pricing
View Details