Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 4 (FGF4) (Active)

This Recombinant Human Fibroblast growth factor 4 (FGF4) (Active) spans the amino acid sequence from region 31-206aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast growth factor 4; FGF-4; Heparin secretory-transforming protein 1; HST; HST-1; HSTF-1; Heparin-binding growth factor 4; HBGF-4; Transforming protein KS3; FGF4; HST; HSTF1; KS3

UniProt

P08620

Expression Region

31-206aa

Tag

Tag free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured in a cell proliferation assay using NIH3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.25-1 ng/mL

Form

Lyophilized powder

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

AA Sequence

APTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 5 (KRT5) Rabbit Polyclonal Antibody
AP06203PU-N 100 µg

Cytokeratin 5 (KRT5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Myosin Phosphatase (PPP1R12A) (NM_002480) Human Over-expression Lysate
LC400883 20 µg

Myosin Phosphatase (PPP1R12A) (NM_002480) Human Over-expression Lysate

Sign In for Pricing
View Details
GOLPH2 (GOLM1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B3]
TA504114AM 100 µL

GOLPH2 (GOLM1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B3]

Sign In for Pricing
View Details
FABP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B2]
TA503549AM 100 µL

FABP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B2]

Sign In for Pricing
View Details
RPL13A (NM_012423) Human Over-expression Lysate
LY402210 100 µg

RPL13A (NM_012423) Human Over-expression Lysate

Sign In for Pricing
View Details
HMGB2 (NM_002129) Human Over-expression Lysate
LC419515 20 µg

HMGB2 (NM_002129) Human Over-expression Lysate

Sign In for Pricing
View Details