Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-7 (IL7) (Active)

This Recombinant Human Interleukin-7 (IL7) (Active) spans the amino acid sequence from region 26-177aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-7; IL-7; IL7

UniProt

P13232

Expression Region

26-177aa

Tag

Tag free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured in a cell proliferation assay using NALM-6 human pre-B cells. The ED50 for this effect is ≤30ng/ml

Form

Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing PBS,5%mannitoland0.01% Tween 80, pH 7.4

AA Sequence

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HS6ST1 Double Nickase Plasmid (h)
sc-405111-NIC 20 µg

HS6ST1 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Prr13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
37783116 3x 1.0 µg

Prr13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal RAD54B Antibody
NBP1-58238 100 µL

Rabbit Polyclonal RAD54B Antibody

Sign In for Pricing
View Details
PARP1 Rabbit Polyclonal Antibody (HRP)
orb2582071 100 µg

PARP1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Tmem88b sgRNA CRISPR Lentivector set (Mouse)
K3603701 3x 1.0 µg

Tmem88b sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
SLC6A16 (NTT5, Orphan Sodium-and Chloride-dependent Neurotransmitter Transporter NTT5, Solute Carrier Family 6 Member 16) (FITC)
133506-FITC 100 µL

SLC6A16 (NTT5, Orphan Sodium-and Chloride-dependent Neurotransmitter Transporter NTT5, Solute Carrier Family 6 Member 16) (FITC)

Sign In for Pricing
View Details