Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oncostatin-M (OSM) (Active)

This Recombinant Human Oncostatin-M (OSM) (Active) spans the amino acid sequence from region 26-221aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Oncostatin-M; OSM

UniProt

P13725

Expression Region

26-221aa

Tag

Tag free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is ≤ 2 ng/mL.

Form

Lyophilized powder

Molecular Weight

22 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

AA Sequence

AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Enah Peptide - C-terminal region (AAP57152)
AAP57152-100UG 100 µg

Enah Peptide - C-terminal region (AAP57152)

Sign In for Pricing
View Details
Edc3 Double Nickase Plasmid (m)
sc-436143-NIC 20 µg

Edc3 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
KCNH5 sgRNA CRISPR Lentivector (Human) (Target 2)
K1119703 1.0 µg DNA

KCNH5 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
LentimiRa-Off-mmu-miR-142a-5p Vector
mm30128 500 ng

LentimiRa-Off-mmu-miR-142a-5p Vector

Sign In for Pricing
View Details
ERI2 Protein Vector (Human) (pPB-N-His)
PV014526 500 ng

ERI2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
8-Hydroxyquinoline-β-D-galactopyranoside (8-Hydroxy-1-azanaphthalene-β-D-galactoside)
H-240-5-10g 10 g

8-Hydroxyquinoline-β-D-galactopyranoside (8-Hydroxy-1-azanaphthalene-β-D-galactoside)

Sign In for Pricing
View Details