Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tissue factor (F3), partial

This Recombinant Human Tissue factor (F3), partial spans the amino acid sequence from region 33-251aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tissue Factor; TF; Coagulation Factor III; Thromboplastin; CD142; F3

UniProt

P13726

Expression Region

33-251aa

Tag

Tag free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Endotoxin

< 1 EU/mg as determined by LAL test.

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from 0.22 μm filtered solution in PBS,5%mannital,0.01% Tween80 pH 7.4.

AA Sequence

SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rana pipiens Transcription factor IIIA (gtf3a)
MBS1059938-01 0.02 mg (E-Coli)

Recombinant Rana pipiens Transcription factor IIIA (gtf3a)

Sign In for Pricing
View Details
Recombinant Rana pipiens Transcription factor IIIA (gtf3a)
MBS1059938-02 0.02 mg (Yeast)

Recombinant Rana pipiens Transcription factor IIIA (gtf3a)

Sign In for Pricing
View Details
Recombinant Rana pipiens Transcription factor IIIA (gtf3a)
MBS1059938-03 0.1 mg (E-Coli)

Recombinant Rana pipiens Transcription factor IIIA (gtf3a)

Sign In for Pricing
View Details
Recombinant Rana pipiens Transcription factor IIIA (gtf3a)
MBS1059938-04 0.1 mg (Yeast)

Recombinant Rana pipiens Transcription factor IIIA (gtf3a)

Sign In for Pricing
View Details
Recombinant Rana pipiens Transcription factor IIIA (gtf3a)
MBS1059938-05 0.02 mg (Baculovirus)

Recombinant Rana pipiens Transcription factor IIIA (gtf3a)

Sign In for Pricing
View Details
Recombinant Rana pipiens Transcription factor IIIA (gtf3a)
MBS1059938-06 0.02 mg (Mammalian-Cell)

Recombinant Rana pipiens Transcription factor IIIA (gtf3a)

Sign In for Pricing
View Details