Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukemia inhibitory factor (LIF) (Active)

This Recombinant Human Leukemia inhibitory factor (LIF) (Active) spans the amino acid sequence from region 23-202aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Leukemia Inhibitory Factor; LIF; Differentiation-Stimulating Factor; D Factor; Melanoma-Derived LPL Inhibitor; MLPLI; Emfilermin; LIF; HILDA

UniProt

P15018

Expression Region

23-202aa

Tag

Tag free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Immunology & Inflammation

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured in the M1 cell differentiation assay. The ED50 is ≤0.2ng/ml.

Form

Lyophilized powder

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

AA Sequence

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINF1 Antibody
orb1281087 100 µL

SERPINF1 Antibody

Sign In for Pricing
View Details
SPDYE3, ID (SPDYE3, Speedy protein E3)
MBS646872-01 0.2 mL

SPDYE3, ID (SPDYE3, Speedy protein E3)

Sign In for Pricing
View Details
SPDYE3, ID (SPDYE3, Speedy protein E3)
MBS646872-02 5x 0.2 mL

SPDYE3, ID (SPDYE3, Speedy protein E3)

Sign In for Pricing
View Details
Human CD62E/SELE (7A9) Monoclonal Antibody
ARO-A15771-01 50 µg

Human CD62E/SELE (7A9) Monoclonal Antibody

Sign In for Pricing
View Details
Human CD62E/SELE (7A9) Monoclonal Antibody
ARO-A15771-02 100 µg

Human CD62E/SELE (7A9) Monoclonal Antibody

Sign In for Pricing
View Details
Human CD62E/SELE (7A9) Monoclonal Antibody
ARO-A15771-03 1 mg

Human CD62E/SELE (7A9) Monoclonal Antibody

Sign In for Pricing
View Details