Recombinant Human Leukemia inhibitory factor (LIF) (Active)
This Recombinant Human Leukemia inhibitory factor (LIF) (Active) spans the amino acid sequence from region 23-202aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Leukemia Inhibitory Factor; LIF; Differentiation-Stimulating Factor; D Factor; Melanoma-Derived LPL Inhibitor; MLPLI; Emfilermin; LIF; HILDA
UniProt
P15018
Expression Region
23-202aa
Tag
Tag free
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Cancer Biology; Immunology & Inflammation
Endotoxin
≤10 EU/mg by the LAL method
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured in the M1 cell differentiation assay. The ED50 is ≤0.2ng/ml.
Form
Lyophilized powder
Molecular Weight
19.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
AA Sequence
SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6320811-01 0.2 mL
MIER3, ID (MIER3, Mesoderm induction early response protein 3) (AP)
Sign In for Pricing
View Details MBS6320811-02 5x 0.2 mL
MIER3, ID (MIER3, Mesoderm induction early response protein 3) (AP)
Sign In for Pricing
View Details 150233 100 µg
CCM2 (Malcavernin, Cerebral Cavernous Malformations 2 Protein, C7orf22, PP10187, MGC4067, MGC4607, MGC74868) discontinued
Sign In for Pricing
View Details 237480 1 Pack (1 Panel (s) x 1 Pack)
W/W029/NL338/TWM-297X105-1 Electrical & Equipment Safety Signs & Labels (Adhesive)
Sign In for Pricing
View Details 