Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vascular endothelial growth factor A, long form (VEGFA) (Active)

This Recombinant Human Vascular endothelial growth factor A, long form (VEGFA) (Active) spans the amino acid sequence from region 27-191aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vascular Endothelial Growth Factor Isoform 165; VEGF165

UniProt

P15692

Expression Region

27-191aa

Tag

Tag free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology; Cell Biology

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured in a cell proliferation assay using HUVEC human umbilicveinendothelial cells. The ED50 for this effect is 0.2-5 ng/mL

Form

Lyophilized powder

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

AA Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thallos Gold AM - gold fluorescent thallium indicator
1391C 500 µg

Thallos Gold AM - gold fluorescent thallium indicator

Sign In for Pricing
View Details
Nandrolone-13C2 Benzoate
TRC-N315006-25MG 25 mg

Nandrolone-13C2 Benzoate

Sign In for Pricing
View Details
Human TRIR activation kit by CRISPRa
GA112302 1 Kit

Human TRIR activation kit by CRISPRa

Sign In for Pricing
View Details
Neptune Filter Tips 100-1250 µL Universal Fit Racked, Low Retention, Pre-Sterilized
BT1250 96 Tips/Rack - 8 Racks/PK

Neptune Filter Tips 100-1250 µL Universal Fit Racked, Low Retention, Pre-Sterilized

Sign In for Pricing
View Details
Trpv4 Mouse Gene Knockout Kit (CRISPR)
KN318311RB 1 Kit

Trpv4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ghrelin Recombinant Rabbit monoclonal Antibody
HA751242 100 µL

Ghrelin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details