Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vascular endothelial growth factor A, long form (VEGFA) (Active)

This Recombinant Human Vascular endothelial growth factor A, long form (VEGFA) (Active) spans the amino acid sequence from region 27-191aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vascular Endothelial Growth Factor Isoform 165; VEGF165

UniProt

P15692

Expression Region

27-191aa

Tag

Tag free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology; Cell Biology

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured in a cell proliferation assay using HUVEC human umbilicveinendothelial cells. The ED50 for this effect is 0.2-5 ng/mL

Form

Lyophilized powder

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

AA Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse EPO Protein (Trx Tag)
PDEM100132-01 20 µg

Recombinant Mouse EPO Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse EPO Protein (Trx Tag)
PDEM100132-02 100 µg

Recombinant Mouse EPO Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse EPO Protein (Trx Tag)
PDEM100132-03 500 µg

Recombinant Mouse EPO Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse EPO Protein (Trx Tag)
PDEM100132-04 1 mg

Recombinant Mouse EPO Protein (Trx Tag)

Sign In for Pricing
View Details
L-Serine-2,3,3-d3
TRC-S270992-5MG 5 mg

L-Serine-2,3,3-d3

Sign In for Pricing
View Details
Apolipoprotein E (APOE) (NM_000041) Human Over-expression Lysate
LY424959 100 µg

Apolipoprotein E (APOE) (NM_000041) Human Over-expression Lysate

Sign In for Pricing
View Details