What is the catalog number for Recombinant Human Kit ligand (KITLG), partial (Active)?

The catalog number for Recombinant Human Kit ligand (KITLG), partial (Active) is orb2657904.

What sizes are available for Recombinant Human Kit ligand (KITLG), partial (Active)?

Recombinant Human Kit ligand (KITLG), partial (Active) is available in the following size(s): 10 µg, 50 µg, 1 mg.

How many pack sizes does Recombinant Human Kit ligand (KITLG), partial (Active) come in?

Recombinant Human Kit ligand (KITLG), partial (Active) is available in 3 different pack sizes.

Is Recombinant Human Kit ligand (KITLG), partial (Active) in stock?

Recombinant Human Kit ligand (KITLG), partial (Active) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Human Kit ligand (KITLG), partial (Active)

This Recombinant Human Kit ligand (KITLG), partial (Active) spans the amino acid sequence from region 26-190aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Kit Ligand; Mast Cell Growth Factor; MGF; Stem Cell Factor; SCF; c-Kit ligand; KITLG; MGF; SCF

UniProt

P21583

Expression Region

26-190aa

Tag

Tag free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is 5-8 ng/mL

Form

Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

AA Sequence

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAA