What sizes are available for Recombinant Human IL12P40&P19 Heterodimer Protein (Active)?

Recombinant Human IL12P40&P19 Heterodimer Protein (Active) is available in the following size(s): 10 µg, 50 µg, 1 mg.

How many pack sizes does Recombinant Human IL12P40&P19 Heterodimer Protein (Active) come in?

Recombinant Human IL12P40&P19 Heterodimer Protein (Active) is available in 3 different pack sizes.

Recombinant Human IL12P40&P19 Heterodimer Protein (Active)

Q: What is the catalog number for Recombinant Human IL12P40&P19 Heterodimer Protein (Active)?

The catalog number for Recombinant Human IL12P40&P19 Heterodimer Protein (Active) is orb2657902.

This Recombinant Human IL12P40&P19 Heterodimer Protein (Active) spans the amino acid sequence from region 23-328aa (IL12P40) &20-189aa (P19) . Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SGRF; IL-23p19; CLMF p40; IL-12 subunit p40; NKSF2

UniProt

P29460

Expression Region

23-328aa (IL12P40) &20-189aa (P19)

Tag

Tag free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED50 for this effect is <0.5 μg/mL.

Form

Lyophilized powder

Molecular Weight

55.0 kDa (IL-23 single chain) ; 36.5 kDa (p40) & 18.5 kDa (p19)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

AA Sequence

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP