Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 9 (FGF9), partial (Active)

This Recombinant Human Fibroblast growth factor 9 (FGF9), partial (Active) spans the amino acid sequence from region 3-208aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast Growth Factor 9; FGF-9; Glia-Activating Factor; GAF; Heparin-Binding Growth Factor 9; HBGF-9; FGF9

UniProt

P31371

Expression Region

3-208aa

Tag

Tag free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured in a cell proliferation assay using NIH3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 1-3 ng/mL.

Form

Lyophilized powder

Molecular Weight

23.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

AA Sequence

PLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6,7-Dihydrodiol-ibudilast
TRC-D134120-50MG 50 mg

6,7-Dihydrodiol-ibudilast

Sign In for Pricing
View Details
Human KCTD19 activation kit by CRISPRa
GA115549 1 Kit

Human KCTD19 activation kit by CRISPRa

Sign In for Pricing
View Details
GPR142 (N-term) Rabbit Polyclonal Antibody
AP51918PU-N 400 µL

GPR142 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Coro1a activation kit by CRISPRa
GA200742 1 Kit

Mouse Coro1a activation kit by CRISPRa

Sign In for Pricing
View Details
Senecionine N-Oxide-D3
TRC-S258657-5MG 5 mg

Senecionine N-Oxide-D3

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Rat IgG1,  15nm
GM-400-15 1 mL

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Rat IgG1, 15nm

Sign In for Pricing
View Details