Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-13 (IL13), partial (Active)

This Recombinant Human Interleukin-13 (IL13), partial (Active) spans the amino acid sequence from region 35-146aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-13; IL-13

UniProt

P35225

Expression Region

35-146aa

Tag

Tag free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured in a cell proliferation assay using TF-1 cells. The ED50 ≤1.0ng/ml, corresponding to a specific activity of ≥1x10^6 U/mg.

Form

Lyophilized powder

Molecular Weight

12.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

AA Sequence

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atn1 siRNA Oligos set (Mouse)
12651174 3x 5 nmol

Atn1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
SPOCK1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-11965R-BF350-01 20 µL

SPOCK1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
SPOCK1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-11965R-BF350-02 100 µL

SPOCK1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Fumarase Peptide
45-641P 0.1 mg

Fumarase Peptide

Sign In for Pricing
View Details
Mkx-set siRNA/shRNA/RNAi Lentivector (Mouse)
30183094 4x 500 ng

Mkx-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Porcine Progesterone Receptor ELISA kit
GTR10452160 96 Well

Porcine Progesterone Receptor ELISA kit

Sign In for Pricing
View Details