Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-15 (IL15) (Active)

This Recombinant Human Interleukin-15 (IL15) (Active) spans the amino acid sequence from region 49-162aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-15; IL-15; IL15

UniProt

P40933

Expression Region

49-162aa

Tag

Tag free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells. The ED50 for this effect is ≤0.5ng/ml.

Form

Lyophilized powder

Molecular Weight

12.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

AA Sequence

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lhpp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7467805 3x 1.0 µg

Lhpp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
DSC3 Rabbit Polyclonal Antibody
orb579403 100 µL

DSC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COX2 / Cyclooxygenase 2 Rabbit mAb
C05115-100ul 100 µL

COX2 / Cyclooxygenase 2 Rabbit mAb

Sign In for Pricing
View Details
Creb1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7617704 1.0 µg DNA

Creb1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Lentiviral mouse Luc7l shRNA (UAS) - Lentiviral mouse Luc7l shRNA (UAS, GFP) plasmid
GTR15177322 1 Vial

Lentiviral mouse Luc7l shRNA (UAS) - Lentiviral mouse Luc7l shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
SRP9 (NM_003133) Human Recombinant Protein
PROTP49458 20 µg

SRP9 (NM_003133) Human Recombinant Protein

Sign In for Pricing
View Details