Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-15 (IL15) (Active)

This Recombinant Human Interleukin-15 (IL15) (Active) spans the amino acid sequence from region 49-162aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-15; IL-15; IL15

UniProt

P40933

Expression Region

49-162aa

Tag

Tag free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells. The ED50 for this effect is ≤0.5ng/ml.

Form

Lyophilized powder

Molecular Weight

12.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

AA Sequence

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMZ-171-Trinocular LED Stero Microscope
MIC5445 1 Each

SMZ-171-Trinocular LED Stero Microscope

Sign In for Pricing
View Details
Lentiviral mouse Ccdc92 shRNA (UAS) - Lentiviral mouseCcdc92 shRNA (UAS, GFP) (25)
GTR15275180 1 Vial

Lentiviral mouse Ccdc92 shRNA (UAS) - Lentiviral mouseCcdc92 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
RPP 5-Plex Real Time PCR Detection
QP2177-01 100 / Box

RPP 5-Plex Real Time PCR Detection

Sign In for Pricing
View Details
FAIM1 Immunizing Peptide
orb16905 100 µg

FAIM1 Immunizing Peptide

Sign In for Pricing
View Details
Lys (Boc) -Leu-Lys (Boc) -OBzl
CCP2586-01 1 mg

Lys (Boc) -Leu-Lys (Boc) -OBzl

Sign In for Pricing
View Details
Lys (Boc) -Leu-Lys (Boc) -OBzl
CCP2586-02 5 mg

Lys (Boc) -Leu-Lys (Boc) -OBzl

Sign In for Pricing
View Details