Recombinant Human R-spondin-1 (RSPO1) (Active)
This Recombinant Human R-spondin-1 (RSPO1) (Active) spans the amino acid sequence from region 21-263aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
RSPO1; R-spondin1; RP11-566C13.1; CRISTIN3; FLJ40906; RSPO Rspo1; R-spondin; Rspondin; RP23-325M14.2; Roof plate-specific spondin-1
UniProt
Q2MKA7
Expression Region
21-263aa
Tag
Tag free
Source
Mammalian cell
Origin
Homo sapiens (Human)
Endotoxin
≤10 EU/mg by the LAL method
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its ability to induce Topflash reporter activity in CHO cells in the presence of 50ng/ml wnt3a. The expected ED50 is<1.0 μg/ml.
Form
Lyophilized powder
Molecular Weight
26.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
AA Sequence
SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![AGO3 Recombinant Rabbit Monoclonal Antibody [JJ201-07]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea8290b/imageurl/et1701-26.webp)
ET1701-26 100 µL
AGO3 Recombinant Rabbit Monoclonal Antibody [JJ201-07]
Sign In for Pricing
View Details 
BNC743049-500 1x 500 µL
Cyclin A1 (XLA1-3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details