Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human R-spondin-1 (RSPO1) (Active)

This Recombinant Human R-spondin-1 (RSPO1) (Active) spans the amino acid sequence from region 21-263aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RSPO1; R-spondin1; RP11-566C13.1; CRISTIN3; FLJ40906; RSPO Rspo1; R-spondin; Rspondin; RP23-325M14.2; Roof plate-specific spondin-1

UniProt

Q2MKA7

Expression Region

21-263aa

Tag

Tag free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its ability to induce Topflash reporter activity in CHO cells in the presence of 50ng/ml wnt3a. The expected ED50 is<1.0 μg/ml.

Form

Lyophilized powder

Molecular Weight

26.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

AA Sequence

SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TIM1/HAVCR1 Protein (aa 1-135, His Tag)
PKSH031288 100 µg

Recombinant Human TIM1/HAVCR1 Protein (aa 1-135, His Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Nose
CS803338 5x 5 µm

Tissue FFPE Sections, Nose

Sign In for Pricing
View Details
CD7 Antibody
KC-47219-01 50 μL

CD7 Antibody

Sign In for Pricing
View Details
CD7 Antibody
KC-47219-02 100 µL

CD7 Antibody

Sign In for Pricing
View Details
CD7 Antibody
KC-47219-03 1 mL

CD7 Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Duodenum
CR559252 5 µg

Tissue Total RNA, Duodenum

Sign In for Pricing
View Details