Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-21 (IL21) (Active)

This Recombinant Human Interleukin-21 (IL21) (Active) spans the amino acid sequence from region 25-162aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-21; IL-21; Za11; IL21

UniProt

Q9HBE4

Expression Region

25-162aa

Tag

Tag free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

≤10 EU/mg by the LAL method

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its ability to enhance IFN-gamma secretion in NK-92 human natural killer lymphoma cells. The ED50 for this effect is ≤ 20 ng/mL.

Form

Lyophilized powder

Molecular Weight

15.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

AA Sequence

HKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Connexin-32 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-1376R-BF647-TR 20 µL

Connexin-32 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Melanoma gp100 Recombinant Rabbit mAb
BS49297-01 50 µL

Melanoma gp100 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Melanoma gp100 Recombinant Rabbit mAb
BS49297-02 100 µL

Melanoma gp100 Recombinant Rabbit mAb

Sign In for Pricing
View Details
HMX1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-18059R-PerCP-Cy5.5 100 µL

HMX1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal SIPA1L1 Antibody [Janelia Fluor 549]
NBP2-81801JF549 0.1 mL

Rabbit Polyclonal SIPA1L1 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
IMPDH1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
24937066 1.0 µg DNA

IMPDH1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details