Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dendroaspis angusticeps Natriuretic peptide DNP

This Recombinant Dendroaspis angusticeps Natriuretic peptide DNP spans the amino acid sequence from region 1-38aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P28374

Expression Region

1-38aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NUTM2F shRNA Plasmid
abx960197-01 150 µg

Human NUTM2F shRNA Plasmid

Sign In for Pricing
View Details
Human NUTM2F shRNA Plasmid
abx960197-02 300 µg

Human NUTM2F shRNA Plasmid

Sign In for Pricing
View Details
RC3H1 Polyclonal Antibody
29344-01 50 µL

RC3H1 Polyclonal Antibody

Sign In for Pricing
View Details
RC3H1 Polyclonal Antibody
29344-02 100 µL

RC3H1 Polyclonal Antibody

Sign In for Pricing
View Details
ATF1 293 Cell Lysate
401434 0.1 mg

ATF1 293 Cell Lysate

Sign In for Pricing
View Details
Biotinylated Anti-CD28 antibody (EN063) ; Rabbit mAb
E33E100063B 100 µL

Biotinylated Anti-CD28 antibody (EN063) ; Rabbit mAb

Sign In for Pricing
View Details