Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dendroaspis angusticeps Natriuretic peptide DNP

This Recombinant Dendroaspis angusticeps Natriuretic peptide DNP spans the amino acid sequence from region 1-38aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P28374

Expression Region

1-38aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3GL3-set siRNA/shRNA/RNAi Lentivector (Human)
43678091 4x 500 ng

SH3GL3-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Tbx3 Antibody
orb2808241 100 µL

Tbx3 Antibody

Sign In for Pricing
View Details
Phospho-IRAK1 (Ser376) Polyclonal Antibody, PE-Cy7 Conjugated
bs-3192R-PE-Cy7-TR 20 µL

Phospho-IRAK1 (Ser376) Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
FAAH (Fatty Acid Amide Hydrolase, FAAH-1, MGC102823, MGC138146) (MaxLight 550)
245896-ML550 100 µL

FAAH (Fatty Acid Amide Hydrolase, FAAH-1, MGC102823, MGC138146) (MaxLight 550)

Sign In for Pricing
View Details
MIL 27 Recombinant Protein
32-1502-10 10 µg

MIL 27 Recombinant Protein

Sign In for Pricing
View Details
Ep-CAM (323/A3)
sc-73491 200 µg/mL

Ep-CAM (323/A3)

Sign In for Pricing
View Details