Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human R-spondin-2 (RSPO2), partial

This Recombinant Human R-spondin-2 (RSPO2), partial spans the amino acid sequence from region 1-205aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Roof plate-specific spondin-2) (hRspo2)

UniProt

Q6UXX9

Expression Region

1-205aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQFRLFSFALIILNCMDYSHCQGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/3131R), CF568 conjugate, 0.1mg/mL
BNC683131-500 1x 500 µL

Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/3131R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PIP4K2C (NM_001146260) Human Over-expression Lysate
LC431328 20 µg

PIP4K2C (NM_001146260) Human Over-expression Lysate

Sign In for Pricing
View Details
NCR3 Rabbit Polyclonal Antibody
AP21200PU-N 100 µg

NCR3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3498), CF405S conjugate, 0.1mg/mL
BNC043498-100 1x 100 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3498), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR561054 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
Rexo5 Mouse Gene Knockout Kit (CRISPR)
KN500274 1 Kit

Rexo5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details