Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial (Active)

This Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), patial spans the amino acid sequence from region 22-145aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R; Glp1r

UniProt

O35659

Expression Region

22-145aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Glp1r at 2 μg/mL can bind Anti-GLP1R recombinant antibody. The EC50 is 141.7-172.4 ng/mL.

Form

Lyophilized powder

Molecular Weight

15.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse RASAL3 shRNA Plasmid
abx983403-01 150 µg

Mouse RASAL3 shRNA Plasmid

Sign In for Pricing
View Details
Mouse RASAL3 shRNA Plasmid
abx983403-02 300 µg

Mouse RASAL3 shRNA Plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal Hepatitis B preS2 Antibody [Alexa Fluor 647]
NB100-93580AF647 0.1 mL

Rabbit Polyclonal Hepatitis B preS2 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Horse Hexosaminidase A Alpha (HEXA) ELISA Kit
MBS9350683-01 48 Well

Horse Hexosaminidase A Alpha (HEXA) ELISA Kit

Sign In for Pricing
View Details
Horse Hexosaminidase A Alpha (HEXA) ELISA Kit
MBS9350683-02 96 Well

Horse Hexosaminidase A Alpha (HEXA) ELISA Kit

Sign In for Pricing
View Details
Horse Hexosaminidase A Alpha (HEXA) ELISA Kit
MBS9350683-03 5x 96 Well

Horse Hexosaminidase A Alpha (HEXA) ELISA Kit

Sign In for Pricing
View Details