Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glucagon-like peptide 2 receptor (GLP2R), partial, Biotinylated

This Recombinant Human Glucagon-like peptide 2 receptor (GLP2R), patial spans the amino acid sequence from region 1-173aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GLP-2 receptor; GLP-2-R; GLP-2R

UniProt

O95838

Expression Region

1-173aa

Tag

C-terminal hFc1-Avi-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVSIKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPSYLPWWSEESSGRAYRHCLAQGTWQTIENATDIWQDDSECSENHSFKQNVDRYA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sept9 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7026703 1.0 µg DNA

Sept9 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Thioredoxin (TRDX, Trx, TRX1, TXN, ATL-derived Factor, ADF, Surface-associated Sulphydryl Protein, SASP) (MaxLight 405)
MBS6193256-01 0.1 mL

Thioredoxin (TRDX, Trx, TRX1, TXN, ATL-derived Factor, ADF, Surface-associated Sulphydryl Protein, SASP) (MaxLight 405)

Sign In for Pricing
View Details
Thioredoxin (TRDX, Trx, TRX1, TXN, ATL-derived Factor, ADF, Surface-associated Sulphydryl Protein, SASP) (MaxLight 405)
MBS6193256-02 5x 0.1 mL

Thioredoxin (TRDX, Trx, TRX1, TXN, ATL-derived Factor, ADF, Surface-associated Sulphydryl Protein, SASP) (MaxLight 405)

Sign In for Pricing
View Details
Recombinant Human CD62E/SELE Protein, N-His
YHD18601 100 μg

Recombinant Human CD62E/SELE Protein, N-His

Sign In for Pricing
View Details
Wnt pathway Inhibitor 4
MBS5819415 Inquire

Wnt pathway Inhibitor 4

Sign In for Pricing
View Details
Slc30a6 (NM_001277279) Rat Untagged Clone
RN216717 10 µg

Slc30a6 (NM_001277279) Rat Untagged Clone

Sign In for Pricing
View Details