S27 protein acetate
S27 protein acetate is a research-grade polypeptide derived from the MRPS27 gene. It is utilized in mitochondrial ribosome studies and has applications in both in vitro and in vivo experimental models to investigate mitochondrial translation and associated cellular functions.
Product Specifications
Product Name Alternative
LLQLSEPPVSELDQLTYNNTMFTNNKITTSHTATPREFR, LLQLSEPPVSELDQLTYNNTMFTNNKITTSHTATPREFRS27proteinacetate
Purity
97.78% (May vary between batches)
Solubility
DMSO:100 mg/mL; H2O:< 1 mg/mL (insoluble or slightly soluble)
Storage Conditions
Store at low temperature, keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.
Notes
For research use only.
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
