Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S27 protein acetate

S27 protein acetate is a research-grade polypeptide derived from the MRPS27 gene. It is utilized in mitochondrial ribosome studies and has applications in both in vitro and in vivo experimental models to investigate mitochondrial translation and associated cellular functions.

Product Specifications

Product Name Alternative

LLQLSEPPVSELDQLTYNNTMFTNNKITTSHTATPREFR, LLQLSEPPVSELDQLTYNNTMFTNNKITTSHTATPREFRS27proteinacetate

Purity

97.78% (May vary between batches)

Solubility

DMSO:100 mg/mL; H2O:< 1 mg/mL (insoluble or slightly soluble)

Storage Conditions

Store at low temperature, keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.

Notes

For research use only.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Surfactant Associated Protein D (SPD) Magnetic Fluorescence Assay Kit
MBS2156836-01 96 Tests

Surfactant Associated Protein D (SPD) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Surfactant Associated Protein D (SPD) Magnetic Fluorescence Assay Kit
MBS2156836-02 5x 96 Tests

Surfactant Associated Protein D (SPD) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Surfactant Associated Protein D (SPD) Magnetic Fluorescence Assay Kit
MBS2156836-03 10x 96 Tests

Surfactant Associated Protein D (SPD) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Clic4 Rat Pre-designed siRNA Set A
HY-RS26891 1 Set

Clic4 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rat Diacylglycerol Kinase Zeta (DGKZ) ELISA Kit
MBS9378739-01 48 Well

Rat Diacylglycerol Kinase Zeta (DGKZ) ELISA Kit

Sign In for Pricing
View Details
Rat Diacylglycerol Kinase Zeta (DGKZ) ELISA Kit
MBS9378739-02 96 Well

Rat Diacylglycerol Kinase Zeta (DGKZ) ELISA Kit

Sign In for Pricing
View Details