Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S27 protein acetate

S27 protein acetate is a research-grade polypeptide derived from the MRPS27 gene. It is utilized in mitochondrial ribosome studies and has applications in both in vitro and in vivo experimental models to investigate mitochondrial translation and associated cellular functions.

Product Specifications

Product Name Alternative

LLQLSEPPVSELDQLTYNNTMFTNNKITTSHTATPREFR, LLQLSEPPVSELDQLTYNNTMFTNNKITTSHTATPREFRS27proteinacetate

Purity

97.78% (May vary between batches)

Solubility

DMSO:100 mg/mL; H2O:< 1 mg/mL (insoluble or slightly soluble)

Storage Conditions

Store at low temperature, keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature.

Notes

For research use only.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDHGA4 Blocking Peptide
33R-3205 0.1 mg

PCDHGA4 Blocking Peptide

Sign In for Pricing
View Details
Lentiviral mouse Krt1 shRNA (UAS) - Lentiviral mouse Krt1 shRNA (UAS, GFP) plasmid
GTR15216766 1 Vial

Lentiviral mouse Krt1 shRNA (UAS) - Lentiviral mouse Krt1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Peroxiredoxin-5 Rabbit pAb, PE-Cy5 conjugated
orb2882753 100 µL

Peroxiredoxin-5 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
B3GNT6 Antibody, FITC conjugated
MBS7110245-01 0.05 mg

B3GNT6 Antibody, FITC conjugated

Sign In for Pricing
View Details
B3GNT6 Antibody, FITC conjugated
MBS7110245-02 0.1 mg

B3GNT6 Antibody, FITC conjugated

Sign In for Pricing
View Details
B3GNT6 Antibody, FITC conjugated
MBS7110245-03 5x 0.1 mg

B3GNT6 Antibody, FITC conjugated

Sign In for Pricing
View Details