Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Protein S100-B (S100B)

Product Specifications

Product Name Alternative

(S-100 protein beta chain) (S-100 protein subunit beta) (S100 calcium-binding protein B)

Abbreviation

Recombinant Bovine S100B protein

Gene Name

S100B

UniProt

P02638

Expression Region

2-92aa

Organism

Bos taurus (Bovine)

Target Sequence

SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE

Tag

N-terminal 6xHis-Avi-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.3 kDa

References & Citations

"Structure of the Ca2+/S100B/NDR kinase peptide complex: insights into S100 target specificity and activation of the kinase." Bhattacharya S., Large E., Heizmann C.W., Hemmings B.A., Chazin W.J. Biochemistry 42:14416-14426 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1514 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV638041 1.0 µg DNA

Olr1514 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
(1- (2-Methylbenzyl) piperidin-3-yl) methanamine hydrochloride
OR1049957-01 100 mg

(1- (2-Methylbenzyl) piperidin-3-yl) methanamine hydrochloride

Sign In for Pricing
View Details
(1- (2-Methylbenzyl) piperidin-3-yl) methanamine hydrochloride
OR1049957-02 250 mg

(1- (2-Methylbenzyl) piperidin-3-yl) methanamine hydrochloride

Sign In for Pricing
View Details
Human GIMAP6 Protein Lysate
MBS8412264-01 0.02 mg

Human GIMAP6 Protein Lysate

Sign In for Pricing
View Details
Human GIMAP6 Protein Lysate
MBS8412264-02 5x 0.02 mg

Human GIMAP6 Protein Lysate

Sign In for Pricing
View Details
Defb52 3'UTR GFP Stable Cell Line
TU253334 1.0 mL

Defb52 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details