What is the catalog number for Transthyretin (A97S) Human, Recombinant?

The catalog number for Transthyretin (A97S) Human, Recombinant is orb2282943.

What sizes are available for Transthyretin (A97S) Human, Recombinant?

Transthyretin (A97S) Human, Recombinant is available in the following size(s): 1 mg.

Is Transthyretin (A97S) Human, Recombinant in stock?

Transthyretin (A97S) Human, Recombinant is currently made to order / not held in immediate stock. Contact us for lead time.

Transthyretin (A97S) Human, Recombinant

Transthyretin (A97S) (1.0mg) Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

The lyophilized protein is readily soluble in PBS pH 7.4.

Molecular Weight

13777 Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSES GELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTSNDSGPRRY TIAALLSPYSYSTTAVVTNPKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

K6368901 3x 1.0 µg

LOC499418 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing

View Details

TR509985 1 Kit

Svs3b Mouse shRNA Plasmid (Locus ID 329557)

Sign In for Pricing

View Details

43892174 3x 5 nmol

Slc16a10 siRNA Oligos set (Mouse)

Sign In for Pricing

View Details

TRV-0008477-01 10 µg

Recombinant Peroxisome Proliferator Activated Receptor Gamma (PPARg)

Sign In for Pricing

View Details

TRV-0008477-02 50 µg

Recombinant Peroxisome Proliferator Activated Receptor Gamma (PPARg)

Sign In for Pricing

View Details

TRV-0008477-03 100 µg

Recombinant Peroxisome Proliferator Activated Receptor Gamma (PPARg)

Sign In for Pricing

View Details