Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Transthyretin (S52P) Human, Recombinant

Transthyretin (S52P) (1.0 mg) Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

The lyophilized protein is readily soluble in PBS pH 7.4.

Molecular Weight

13771 Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSEPGELHGLTTEEEFVEGIYKV EIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAALMSPYSYSTTAVVTNPKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Hydroxy-L-tryptophan
RM1539-1G 1 unit

5-Hydroxy-L-tryptophan

Sign In for Pricing
View Details
Tas2r116 (NM_053212) Mouse Tagged Lenti ORF Clone
MR219824L4 10 µg

Tas2r116 (NM_053212) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Biotin-Linked Antibody to Myosin(Myo)
MBS2007069-01 0.1 mL

Biotin-Linked Antibody to Myosin(Myo)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Myosin(Myo)
MBS2007069-02 0.2 mL

Biotin-Linked Antibody to Myosin(Myo)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Myosin(Myo)
MBS2007069-03 0.5 mL

Biotin-Linked Antibody to Myosin(Myo)

Sign In for Pricing
View Details
Biotin-Linked Antibody to Myosin(Myo)
MBS2007069-04 1 mL

Biotin-Linked Antibody to Myosin(Myo)

Sign In for Pricing
View Details