What is the catalog number for Transthyretin (S52P) Human, Recombinant?

The catalog number for Transthyretin (S52P) Human, Recombinant is orb2282942.

What sizes are available for Transthyretin (S52P) Human, Recombinant?

Transthyretin (S52P) Human, Recombinant is available in the following size(s): 1 mg.

Is Transthyretin (S52P) Human, Recombinant in stock?

Transthyretin (S52P) Human, Recombinant is currently made to order / not held in immediate stock. Contact us for lead time.

Transthyretin (S52P) Human, Recombinant

Transthyretin (S52P) (1.0 mg) Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

The lyophilized protein is readily soluble in PBS pH 7.4.

Molecular Weight

13771 Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSEPGELHGLTTEEEFVEGIYKV EIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAALMSPYSYSTTAVVTNPKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PC3467-01 100 mg

3,3,3-Trifluoropropane-1-sulphonyl chloride

Sign In for Pricing

View Details

PC3467-02 250 mg

3,3,3-Trifluoropropane-1-sulphonyl chloride

Sign In for Pricing

View Details

PC3467-03 25 g

3,3,3-Trifluoropropane-1-sulphonyl chloride

Sign In for Pricing

View Details

PC3467-04 100 g

3,3,3-Trifluoropropane-1-sulphonyl chloride

Sign In for Pricing

View Details

LC427650 20 µg

PKR (EIF2AK2) (NM_001135651) Human Over-expression Lysate

Sign In for Pricing

View Details

sc-432328 20 µg

CHDH CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing

View Details