Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein E2, (ApoE2) Human Recombinant

Apolipoprotein E2, (ApoE2) (1mg) Human Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Metabolism Research

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

ApoE is soluble in PBS.

Molecular Weight

34 kDa

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKCLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH
More Discoveries

Explore Other Products

Browse additional items from our catalog

PIK3IP1 (NM_052880) Human Over-expression Lysate
LS113791-100ug 100 µg

PIK3IP1 (NM_052880) Human Over-expression Lysate

Sign In for Pricing
View Details
ULK1, phosphorylated (S467) (ULK1, KIAA0722, Serine/threonine-protein kinase ULK1, Autophagy-related protein 1 homolog, Unc-51-like kinase 1) (FITC) discontinued
043597-FITC 200 µL

ULK1, phosphorylated (S467) (ULK1, KIAA0722, Serine/threonine-protein kinase ULK1, Autophagy-related protein 1 homolog, Unc-51-like kinase 1) (FITC) discontinued

Sign In for Pricing
View Details
APBA3 Peptide
DF3768-BP 1 mg

APBA3 Peptide

Sign In for Pricing
View Details
DYRK2 Protein Vector (Human) (pPB-N-His)
PV013402 500 ng

DYRK2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
GS28 Polyclonal Antibody
E44H04955 100 µL

GS28 Polyclonal Antibody

Sign In for Pricing
View Details
Olr327 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7320105 3x 1.0 µg

Olr327 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details